PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000228252
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 341aa    MW: 38039.1 Da    PI: 5.8068
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000228252genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.46.8e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l +++++ G g+W++ ++  g++R++k+c++rw +yl
    MDP0000228252 14 KGPWTPEEDQKLMKYIQKNGHGSWRALPKLAGLNRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding54.82.1e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++++eE++ +++++  lG++ W++Ia +++ gRt++++k++w+++l
    MDP0000228252  67 RGKFSQEEEQTILNLHSILGNK-WSAIAGHLP-GRTDNEIKNFWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.4E-26564IPR009057Homeodomain-like
PROSITE profilePS5129418.349961IPR017930Myb domain
SuperFamilySSF466897.86E-3211108IPR009057Homeodomain-like
SMARTSM007172.5E-141363IPR001005SANT/Myb domain
PfamPF002494.2E-171461IPR001005SANT/Myb domain
CDDcd001672.32E-111661No hitNo description
PROSITE profilePS5129426.44262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-2765117IPR009057Homeodomain-like
SMARTSM007172.7E-1666114IPR001005SANT/Myb domain
PfamPF002496.2E-1667112IPR001005SANT/Myb domain
CDDcd001673.22E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MGRSPCCDES GLKKGPWTPE EDQKLMKYIQ KNGHGSWRAL PKLAGLNRCG KSCRLRWTNY  60
LRPDIKRGKF SQEEEQTILN LHSILGNKWS AIAGHLPGRT DNEIKNFWNT HLKKKLIQMG  120
FDPMTHRPRT DIFSSLPHLL ALVNLKELLD HGSSHQSCWD EQALRLQAEA SQMAXLQYLQ  180
CLLQPNNNSF GAATPNNLND FIDMETFNLL NXLGSSQLDI QDPTAQYPVG DFQPVVQDNS  240
VPFSHLPDLQ TYPTPPNKDM VNDQAPDQFT ALSQGENSPN NPWNIPSSSN TTLSPTSVAP  300
PMTVTETSVS NNLGDACSTS SYAGVATSAW SDLLFEDPFF Q
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-30121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008354822.10.0PREDICTED: transcription factor MYB39-like
RefseqXP_008345730.10.0PREDICTED: transcription factor MYB39-like
TrEMBLM5W5260.0M5W526_PRUPE; Uncharacterized protein
STRINGPOPTR_0005s07590.11e-155(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.11e-105myb domain protein 93